PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30170.m013590
Common NameLOC8265271, RCOM_1586710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 471aa    MW: 53788.6 Da    PI: 6.0023
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30170.m013590genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS309.48.2e-95964513374
           GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                    + L++cAeav++++l+la+ +L+++  l++++++++q +aa f+eA+++r++r        l p+  +    s    ++++f++   ++k +hlta
  30170.m013590  96 NMLIACAEAVEENNLHLAEIILSQI--LVNSKARATQSMAALFAEAMSSRVYR--------LYPQYFD---YSYLNDIQRYFYKEWSYVKAAHLTA 178
                    78*********************99..6888999*******************........5566665...4455556889999999********* PP

           GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                    N+ I e ++g++++H+iDf i++G+QW  L+q La+Rp+gpp++Ri g+g p++++++ l+++g++La++Ae+l+++fe++ ++a +l+dl+  +L
  30170.m013590 179 NREIFETFAGKKHIHVIDFFINHGTQWSDLMQDLAARPGGPPTIRISGIGFPNHDNSDYLKSVGWKLAQLAETLNIDFEYRGFLAYNLADLDAAML 274
                    ***********************************************************************************9************ PP

           GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                    +++++Ea+aVn v++lh+ll++++++++    +L++vk+++P++++++eqe+d n++ F  rf e+++y+s l++s e +      ++      +l
  30170.m013590 275 ELRTHEAIAVNAVFALHKLLARPGDIHK----LLSMVKHIEPEIFTIIEQESDNNDQGFSYRFNECINYFSFLLESSEGS------TNCLDTYIFL 360
                    **************************99....*********************************************999......2333334568 PP

           GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.......yrveeesgslvlgWkdrpLvsvSaWr 374
                    +++i n+v ceg+ r+er e+l +Wr rle+aGF  ++l++++ + a+ l ++ + +         ++ee++g+ +lgW++rpL+++SaWr
  30170.m013590 361 RNQIHNIVVCEGEYRVERYEKLTRWRTRLEAAGFVLIHLGSNVGEYASFLSSQPATRNmlqasskCTIEENNGCWMLGWRTRPLIAISAWR 451
                    899****************************************9999998766543322222223788899*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.04868424IPR005202Transcription factor GRAS
PfamPF035142.8E-9296451IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MHWVFPHPSS ANHDSLSKPS STTSPNITDH AEHFQLNSSF SSRESERFNL EPQHSSACSS  60
SSTVDGPYRP FSDLAKSIHP ILEIDFEQNT RVPLFNMLIA CAEAVEENNL HLAEIILSQI  120
LVNSKARATQ SMAALFAEAM SSRVYRLYPQ YFDYSYLNDI QRYFYKEWSY VKAAHLTANR  180
EIFETFAGKK HIHVIDFFIN HGTQWSDLMQ DLAARPGGPP TIRISGIGFP NHDNSDYLKS  240
VGWKLAQLAE TLNIDFEYRG FLAYNLADLD AAMLELRTHE AIAVNAVFAL HKLLARPGDI  300
HKLLSMVKHI EPEIFTIIEQ ESDNNDQGFS YRFNECINYF SFLLESSEGS TNCLDTYIFL  360
RNQIHNIVVC EGEYRVERYE KLTRWRTRLE AAGFVLIHLG SNVGEYASFL SSQPATRNML  420
QASSKCTIEE NNGCWMLGWR TRPLIAISAW RADNRILISD EDGALQKLER M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-34934513375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510069.10.0PREDICTED: DELLA protein GAIP-B
TrEMBLB9R6X60.0B9R6X6_RICCO; DELLA protein GAIP-B, putative
STRINGPOPTR_0010s12080.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.11e-123GRAS family protein